PMPCA Rabbit Polyclonal Antibody

CAT#: TA331965

Rabbit Polyclonal Anti-PMPCA Antibody

Product Images

Host: Rabbit; Target Name: PMPCA; Sample Tissue: MCF7 Whole Cell lysates; Antibody Dilution: 1.0ug/ml; PMPCA is supported by BioGPS gene expression data to be expressed in MCF7

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PMPCA Antibody is: synthetic peptide directed towards the C-terminal region of Human PMPCA. Synthetic peptide located within the following region: IRNVKPEDVKRVASKMLRGKPAVAALGDLTDLPTYEHIQTALSSKDGRLP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: peptidase, mitochondrial processing alpha subunit
• Database Link:
  NP_055975
  Entrez Gene 23203 Human
  UniProt ID Q10713
• Background: PMPCA cleaves presequences (transit peptides) from mitochondrial protein precursors.
• Synonyms: Alpha-MPP; INPP5E; P-55; SCAR2
• Note: Immunogen sequence homology: Human: 100%; Rat: 93%; Mouse: 93%; Horse: 92%; Bovine: 86%; Pig: 79%; Guinea pig: 79%; Dog: 77%

Reference Data

• Protein Families: Druggable Genome, Protease