Antibodies

View as table Download

Rabbit Polyclonal Anti-PPME1 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPME1 antibody: synthetic peptide directed towards the N terminal of human PPME1. Synthetic peptide located within the following region: PGRKRDFSPVPWSQYFESMEDVEVENETGKDTFRVYKSGSEGPVLLLLHG

Rabbit Polyclonal Anti-PPME1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPME1 antibody: synthetic peptide directed towards the N terminal of human PPME1. Synthetic peptide located within the following region: MSALEKSMHLGRLPSRPPLPGSGGSQSGAKMRMGPGRKRDFSPVPWSQYF

Rabbit polyclonal Caspase 10 antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Caspase 10.