PPME1 Rabbit Polyclonal Antibody

CAT#: TA345060

Rabbit Polyclonal Anti-PPME1 Antibody - N-terminal region

Product Images

Host: Rabbit; Target Name: PPME1; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0 ug/ml

• 

  WB Suggested Anti-PPME1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: NCI-H226 cell lysatePPME1 is strongly supported by BioGPS gene expression data to be expressed in NCI-H226

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PPME1 antibody: synthetic peptide directed towards the N terminal of human PPME1. Synthetic peptide located within the following region: MSALEKSMHLGRLPSRPPLPGSGGSQSGAKMRMGPGRKRDFSPVPWSQYF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: protein phosphatase methylesterase 1
• Database Link:
  NP_057231
  Entrez Gene 51400 Human
  UniProt ID Q9Y570
• Background: This gene encodes a protein phosphatase methylesterase localized to the nucleus. The encoded protein acts on the protein phosphatase-2A catalytic subunit and supports the ERK pathway through dephosphorylation of regulatory proteins. It plays a role in malignant glioma progression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2012]
• Synonyms: PME-1
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%

Reference Data

• Protein Families: Druggable Genome