Rabbit anti-PRDX4 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PRDX4 |
Rabbit anti-PRDX4 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PRDX4 |
Peroxiredoxin 4 (PRDX4) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 89-118 amino acids from the Central region of human PRDX4 |
Anti-PRDX4 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 38-271 amino acids of human peroxiredoxin 4 |
Rabbit Polyclonal Anti-PRDX4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRDX4 antibody is: synthetic peptide directed towards the N-terminal region of Human PRDX4. Synthetic peptide located within the following region: LLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSL |
Rabbit Polyclonal Anti-PRDX4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRDX4 antibody is: synthetic peptide directed towards the C-terminal region of Human PRDX4. Synthetic peptide located within the following region: GLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWK |