Antibodies

Jump to Filters
View as table Download
Peroxiredoxin 4 (PRDX4) Rabbit Polyclonal Antibody
TA327054

USD 374.00

3 Weeks

Rabbit anti-PRDX4 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRDX4
Peroxiredoxin 4 (PRDX4) (Center) Rabbit Polyclonal Antibody
AP53439PU-N

USD 450.00

2 Weeks

Peroxiredoxin 4 (PRDX4) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 89-118 amino acids from the Central region of human PRDX4
Peroxiredoxin 4 (PRDX4) Rabbit Polyclonal Antibody
TA321764

USD 345.00

4 Weeks

Anti-PRDX4 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 38-271 amino acids of human peroxiredoxin 4
Peroxiredoxin 4 (PRDX4) Rabbit Polyclonal Antibody
TA338130

USD 375.00

5 Days

Rabbit Polyclonal Anti-PRDX4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRDX4 antibody is: synthetic peptide directed towards the N-terminal region of Human PRDX4. Synthetic peptide located within the following region: LLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSL
Peroxiredoxin 4 (PRDX4) Rabbit Polyclonal Antibody
TA338131

USD 375.00

5 Days

Rabbit Polyclonal Anti-PRDX4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRDX4 antibody is: synthetic peptide directed towards the C-terminal region of Human PRDX4. Synthetic peptide located within the following region: GLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWK