Peroxiredoxin 4 (PRDX4) Rabbit Polyclonal Antibody

CAT#: TA338130

Rabbit Polyclonal Anti-PRDX4 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "PRDX4"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PRDX4 antibody is: synthetic peptide directed towards the N-terminal region of Human PRDX4. Synthetic peptide located within the following region: LLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 29 kDa
Gene Name peroxiredoxin 4
Background The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. The protein is localized to the cytoplasm. Peroxidases of the peroxiredoxin family reduce hydrogen peroxide and alkyl hydroperoxides to water and alcohol with the use of reducing equivalents derived from thiol-containing donor molecules. This protein has been found to play a regulatory role in the activation of the transcription factor NF-kappaB.
Synonyms AOE37-2; AOE372; HEL-S-97n; PRX-4
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Bovine: 93%; Rabbit: 93%; Dog: 86%; Horse: 86%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.