Antibodies

Jump to Filters
View as table Download
PTBP1 Rabbit Polyclonal Antibody
TA332440

USD 275.00

3 Weeks

Rabbit anti-PTBP1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PTBP1
PTBP1 Rabbit Polyclonal Antibody
TA345811

USD 475.00

5 Days

Rabbit Polyclonal Anti-PTBP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTBP1 antibody: synthetic peptide directed towards the N terminal of human PTBP1. Synthetic peptide located within the following region: RGSDELFSTCVTNGPFIMSSNSASAANGNDSKKFKGDSRSAGVPSRVIHI
PTBP1 Rabbit Polyclonal Antibody
TA345812

USD 475.00

5 Days

Rabbit Polyclonal Anti-PTBP1 Antibody

Applications WB
Reactivities Bovine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish, Dog, Pig, Horse
Conjugation Unconjugated
Immunogen The immunogen for anti-PTBP1 antibody: synthetic peptide directed towards the middle region of human PTBP1. Synthetic peptide located within the following region: KGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI