Antibodies

Jump to Filters
View as table Download
RNF20 Rabbit Polyclonal Antibody
TA319965

USD 430.00

5 Days

Rabbit Polyclonal RNF20 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen RNF20 antibody was raised against a 19 amino acid peptide near the amino terminus of human RNF20.
RNF20 Rabbit Polyclonal Antibody
TA329882

USD 375.00

5 Days

Rabbit Polyclonal Anti-RNF20 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNF20 antibody: synthetic peptide directed towards the N terminal of human RNF20. Synthetic peptide located within the following region: LKRYDLEQGLGDLLTERKALVVPEPEPDSDSNQERKDDRERGEGQEPAFS
RNF20 Rabbit Polyclonal Antibody
TA330448

USD 375.00

5 Days

Rabbit Polyclonal Anti-RNF20 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNF20 antibody: synthetic peptide directed towards the middle region of human RNF20. Synthetic peptide located within the following region: KEREREREREKEKEREREKQKLKESEKERDSAKDKEKGKHDDGRKKEAEI
RNF20 Rabbit Polyclonal Antibody
TA350359

USD 345.00

In Stock

Rabbit Polyclonal Anti-RNF20 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human RNF20