Antibodies

View as table Download

Rabbit Polyclonal DR3 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen DR3 antibody was raised against a peptide corresponding to amino acids in extracellular domain of human DR3 precusor. The immunogen is located within amino acids 50 - 100 of DR3.

Rabbit Polyclonal DR3 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DR3 antibody was raised against a 20 amino acid peptide near the carboxy terminus of human DR3. The immunogen is located within the last 50 amino acids of DR3.

DR3 (TNFRSF25) (1-210) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 1 and 210 of Human DR3

Rabbit Polyclonal DR3 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen DR3 antibody was raised against a 16 amino acid peptide near the amino terminus of human DR3. The immunogen is located within the first 50 amino acids of DR3.

DR3 (TNFRSF25) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to residues surrounding amino acids 378 of Mouse DR3

Rabbit Polyclonal Anti-TNFRSF25 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFRSF25 antibody: synthetic peptide directed towards the middle region of human TNFRSF25. Synthetic peptide located within the following region: GRFRDQQYEMLKRWRQQQPAGLGAVYAALERMGLDGCVEDLRSRLQRGP

Anti-TNFRSF25 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 221-417 amino acids of human tumor necrosis factor receptor superfamily, member 25