Antibodies

View as table Download

Rabbit Polyclonal Anti-GNL3 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNL3 antibody: synthetic peptide directed towards the middle region of human GNL3. Synthetic peptide located within the following region: RKQEEREDDKDSDQETVDEEVDENSSGMFAAEETGEALSEETTAGEQSTR

Rabbit Polyclonal Anti-GNL3 Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GNL3 antibody: synthetic peptide directed towards the N terminal of human GNL3. Synthetic peptide located within the following region: MTCHKRYKIQKKVREHHRKLRKEAKKRGHKKPRKDPGVPNSAPFKEALLR

Rabbit polyclonal Hsp22 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat. Not yet tested on other species
Conjugation Unconjugated
Immunogen Human Hsp22

Rabbit Polyclonal Anti-GNL3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human GNL3