Rabbit Polyclonal Anti-NOSTRIN Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | NOSTRIN antibody was raised against a 17 amino acid peptide near the carboxy terminus of human NOSTRIN. |
Rabbit Polyclonal Anti-NOSTRIN Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | NOSTRIN antibody was raised against a 17 amino acid peptide near the carboxy terminus of human NOSTRIN. |
Rabbit Polyclonal Anti-ATG4A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ATG4A antibody was raised against an 18 amino acid peptide near the carboxy terminus of human ATG4A. |
ATG4A Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ATG4A |
Rabbit polyclonal anti-ATG4A antibody
Applications | IF, IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human ATG4A. |
Rabbit Polyclonal anti-ATG4A antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATG4A antibody: synthetic peptide directed towards the N terminal of human ATG4A. Synthetic peptide located within the following region: DAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKEYQRILQCFLDR |
Rabbit Polyclonal anti-ATG4A antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATG4A antibody: synthetic peptide directed towards the middle region of human ATG4A. Synthetic peptide located within the following region: PQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGTVNDQTF |
Rabbit Polyclonal Anti-ATG4A Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ATG4A |