Germany
Japan
United Kingdom
China
Rabbit anti-USP16 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human USP16 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-USP16 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-USP16 antibody: synthetic peptide directed towards the N terminal of human USP16. Synthetic peptide located within the following region: CKTDNKVKDKAEEETEEKPSVWLCLKCGHQGCGRNSQEQHALKHYLTPRS |
USP16 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 131-160 amino acids from the N-terminal region of human USP16 |
Active filters
Target Symbol
- USP16
Antibody Hosts
- Rabbit
Families
- Protease