USP16 Rabbit Polyclonal Antibody

CAT#: TA338905

Rabbit Polyclonal Anti-USP16 Antibody

Product Images

WB Suggested Anti-USP16 Antibody Titration: 2.5 ug/ml; Positive Control: HepG2 cell lysate

• 

  Sample Type: Human brain stem cells (NT2) Primary Antibody Dilution: 1: 500; Secondary Antibody: Goat anti-rabbit Alexa Fluor 594; Secondary Antibody: ilution: 1: 1000; Color/Signal Descriptions: Red: USP16 Blue: DAPI; Gene Name: USP16; Submitted by: Dr.

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-USP16 antibody: synthetic peptide directed towards the N terminal of human USP16. Synthetic peptide located within the following region: CKTDNKVKDKAEEETEEKPSVWLCLKCGHQGCGRNSQEQHALKHYLTPRS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: ubiquitin specific peptidase 16
• Database Link:
  NP_001001992
  Entrez Gene 10600 Human
  UniProt ID Q9Y5T5
• Background: This gene encodes a deubiquitinating enzyme that is phosphorylated at the onset of mitosis and then dephosphorylated at the metaphase/anaphase transition. It can deubiquitinate H2A, one of two major ubiquitinated proteins of chromatin, in vitro and a mutant form of the protein was shown to block cell division. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
• Synonyms: UBP-M; UBPM
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Pig: 92%; Rat: 86%; Rabbit: 86%; Guinea pig: 86%; Mouse: 79%

Reference Data

• Protein Families: Protease