Antibodies

Jump to Filters
View as table Download
Clusterin Rabbit Polyclonal Antibody
TA332402

USD 275.00

3 Weeks

Rabbit anti-CLU Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CLU
Clusterin (CLU) (Alpha) Rabbit Polyclonal Antibody
AP20482PU-N

USD 407.00

2 Weeks

Clusterin (CLU) (Alpha) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Clusterin (CLU) (N-term) Rabbit Polyclonal Antibody
AP50979PU-N

USD 450.00

2 Weeks

Clusterin (CLU) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 71-99 amino acids from the N-terminal region of human CLU
Clusterin Rabbit Polyclonal Antibody
TA306332

USD 430.00

5 Days

Rabbit Polyclonal Clusterin Antibody

Applications IHC, WB
Reactivities Human
Immunogen Clusterin antibody was raised recombinant human Clusterin isoform 1.
Clusterin (CLU) Rabbit Polyclonal Antibody
TA321404

USD 345.00

4 Weeks

Anti-CLU Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 230 amino acids of human clusterin
Clusterin (CLU) Rabbit Polyclonal Antibody
TA343117

USD 375.00

5 Days

Rabbit Polyclonal Anti-CLU Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLU antibody: synthetic peptide directed towards the C terminal of human CLU. Synthetic peptide located within the following region: CREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLN
Clusterin (CLU) Rabbit Polyclonal Antibody
TA351991

USD 345.00

In Stock

Rabbit Polyclonal Anti-CLU Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLU