Clusterin (CLU) Rabbit Polyclonal Antibody

CAT#: TA343117

Rabbit Polyclonal Anti-CLU Antibody

Product Images

equine cartilage explants

• 

  CLU antibody validated by WB using Fetal Brain Lysate at 1 ug/ml.

• 

  Lanes: 1. 40 ug human HK2 cell (kidney proximal tubular cell line) lysate; 2. 40 ug H2O2 treated human HK2 Cell lysate; 3. 40 ug H2O2 treated human HK2 Cell lysate; 4. 40 ug H2O2 treated human HK2 Cell lysate; 5. 40 ug H2O2 treated human HK2 Cell lysate;

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CLU antibody: synthetic peptide directed towards the C terminal of human CLU. Synthetic peptide located within the following region: CREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: clusterin
• Database Link:
  NP_001822
  Entrez Gene 1191 Human
  UniProt ID P10909
• Background: The protein encoded by this gene is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants.
• Synonyms: AAG4; APO-J; APOJ; CLI; CLU1; CLU2; KUB1; NA1; NA2; SGP-2; SGP2; SP-40; TRPM-2; TRPM2
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Rabbit: 91%; Pig: 86%; Rat: 86%; Mouse: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein