Antibodies

Jump to Filters
View as table Download
EDIL3 Rabbit Polyclonal Antibody
TA309634

USD 424.00

2 Weeks

Rabbit Polyclonal Del-1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human protein (within residues 200-350). [Swiss-Prot# O43854]
EDIL3 Rabbit Polyclonal Antibody
TA340067

USD 375.00

5 Days

Rabbit Polyclonal Anti-EDIL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EDIL3 antibody: synthetic peptide directed towards the N terminal of human EDIL3. Synthetic peptide located within the following region: EPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNI
EDIL3 Rabbit Polyclonal Antibody
TA349919

USD 345.00

In Stock

Rabbit Polyclonal Anti-EDIL3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human EDIL3