EDIL3 Rabbit Polyclonal Antibody

CAT#: TA340067

Rabbit Polyclonal Anti-EDIL3 Antibody

Product Images

WB Suggested Anti-EDIL3 Antibody Titration: 0.2-1 ug/ml; Positive Control: 293T cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EDIL3 antibody: synthetic peptide directed towards the N terminal of human EDIL3. Synthetic peptide located within the following region: EPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: EGF like repeats and discoidin domains 3
• Database Link:
  NP_005702
  Entrez Gene 10085 Human
  UniProt ID O43854
• Background: The protein encoded by this gene is an integrin ligand. It plays an important role in mediating angiogenesis and may be important in vessel wall remodeling and development. It also influences endothelial cell behavior.
• Synonyms: DEL1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein