Enkephalin (PENK) rabbit polyclonal antibody
Applications | IHC |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Enkephalin (PENK) rabbit polyclonal antibody
Applications | IHC |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Enkephalin (PENK) rabbit polyclonal antibody
Applications | IF, IHC |
Reactivities | Birds, Mammalian |
Conjugation | Unconjugated |
Immunogen | Synthetic methionine enkephalin coupled to bovine thyroglobulin (BTg) with glutaraldehyde. |
Rabbit Polyclonal Anti-PENK Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PENK antibody: synthetic peptide directed towards the middle region of human PENK. Synthetic peptide located within the following region: DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRG |
Enkephalin (PENK) rabbit polyclonal antibody
Applications | IF, IHC |
Reactivities | Mammalian |
Conjugation | Unconjugated |
Immunogen | Synthetic leucine enkephalin coupled to keyhole limpet hemocyanin (KLH) to bovine thyroglobulin and BSA with glutaraldehyde. |