Enkephalin (PENK) Rabbit Polyclonal Antibody

CAT#: TA345157

Rabbit Polyclonal Anti-PENK Antibody - middle region

Product Images

WB Suggested Anti-PENK Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PENK antibody: synthetic peptide directed towards the middle region of human PENK. Synthetic peptide located within the following region: DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: proenkephalin
• Database Link:
  NP_006202
  Entrez Gene 5179 Human
  UniProt ID P01210
• Background: Met- and Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress. PENK(114-133) and PENK(237-258) increase glutamate release in the striatum. PENK(114-133) decreases GABA concentration in the striatum.
• Synonyms: enkephalin A; preproenkephalin; proenkephalin
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Secreted Protein