Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Enkephalin (PENK) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Birds, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic methionine enkephalin coupled to bovine thyroglobulin (BTg) with glutaraldehyde. |
Rabbit Polyclonal Anti-PENK Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PENK antibody: synthetic peptide directed towards the middle region of human PENK. Synthetic peptide located within the following region: DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRG |
Rabbit polyclonal anti Met-Enkephalin; neat antiserum
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Try-Gly-Gly-Phe-Met-OH coupled to carrier protein. |
Enkephalin (PENK) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic leucine enkephalin coupled to keyhole limpet hemocyanin (KLH) to bovine thyroglobulin and BSA with glutaraldehyde. |
Goat Polyclonal Antibody against PENK
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RSHHQDGSDNEE, from the internal region of the protein sequence according to NP_006202.1. |
Enkephalin (PENK) mouse monoclonal antibody, clone 1194/334, Purified
| Applications | ELISA |
| Reactivities | Mammalian |
Rabbit polyclonal anti BAM-12P; purified rabbit IgG
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Try-Gly-Gly-Phe-Met-Arg-Arg-Val-Gly-Arg-Pro-Glu- NH2 coupled to a carrier protein. |
Rabbit polyclonal anti BAM-22P; neat antiserum
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Met-Arg-Arg-Val-Gly-Arg-Pro-Glu- Trp-Trp-Met-Asp-Tyr-Gln-Lys-Arg-Tyr-Gly-NH2 coupled to a carrier protein. |
Rabbit polyclonal anti BAM-22P; purified rabbit IgG
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Met-Arg-Arg-Val-Gly-Arg-Pro-Glu- Trp-Trp-Met-Asp-Tyr-Gln-Lys-Arg-Tyr-Gly-NH2 coupled to a carrier protein. |
Rabbit polyclonal anti BAM-12P; neat antiserum
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Try-Gly-Gly-Phe-Met-Arg-Arg-Val-Gly-Arg-Pro-Glu- NH2 coupled to carrier protein. |
Rabbit polyclonal anti Leu-Enkephalin; diluted antiserum
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-NH2 coupled to carrier protein. |
Rabbit polyclonal anti Leu-Enkephalin; purified rabbit IgG
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-NH2 coupled to a carrier protein. |
Rabbit polyclonal anti Leu-Enkephalin; neat antiserum
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-NH2 coupled to carrier protein. |
Rabbit polyclonal anti Met-Enkephalin; diluted antiserum
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Try-Gly-Gly-Phe-Met-OH coupled to carrier protein. |
Rabbit polyclonal anti Met-Enkephalin-Arg-Gly-Leu; neat antiserum
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Met-Arg-Gly-Leu-NH2 coupled to carrier protein. |
Rabbit polyclonal anti Met-Enkephalin-Arg-Gly-Leu; purified rabbit IgG
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Met-Arg-Gly-Leu-NH2 coupled to a carrier protein. |
Rabbit polyclonal anti Met-Enkephalin; purified rabbit IgG
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Try-Gly-Gly-Phe-Met-OH coupled to a carrier protein. |
Rabbit polyclonal anti Met-Enkephalin-Arg-Phe; neat antiserum
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Met-Arg-Phe-NH2 coupled to carrier protein. |
Rabbit polyclonal anti Met-Enkephalin-Arg-Phe; purified rabbit IgG
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Met-Arg-Phe-NH2 coupled to a carrier protein. |
Rabbit polyclonal anti Peptide F (bo); purified rabbit IgG
| Applications | ELISA |
| Reactivities | Bovine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Met-Lys-Lys-Met-Asp-Glu-Leu-Tyr- Pro-Leu-Glu-Val-Glu-Glu-Glu-Ala-Asn-Gly-Gly-Glu-Val-Leu-Gly-Lys-Arg- Tyr-Gly-Gly-Phe-Met-OH coupled to a carrier protein. |
Rabbit polyclonal anti Peptide F (bo); neat antiserum
| Applications | ELISA |
| Reactivities | Bovine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Met-Lys-Lys-Met-Asp-Glu-Leu-Tyr- Pro-Leu-Glu-Val-Glu-Glu-Glu-Ala-Asn-Gly-Gly-Glu-Val-Leu-Gly-Lys-Arg- Tyr-Gly-Gly-Phe-Met-OH coupled to carrier protein. |
PENK Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 25-267 of human PENK (NP_001129162.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- PENK