Antibodies

View as table Download

Rabbit polyclonal Syntaxin 1A (Ser14) antibody(Phospho-specific)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Syntaxin 1A around the phosphorylation site of serine 14 (K-D-SP-D-D)
Modifications Phospho-specific

Syntaxin 1a (STX1A) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 36~65 amino acids from the N-terminal region of Human STX1A

Rabbit Polyclonal Syntaxin 1A Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Syntaxin 1A

Rabbit Polyclonal Syntaxin 1A (Ser14) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Syntaxin 1A around the phosphorylation site of Serine 14
Modifications Phospho-specific

Rabbit Polyclonal Anti-STX1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STX1A antibody: synthetic peptide directed towards the N terminal of human STX1A. Synthetic peptide located within the following region: KDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENV

Rabbit Polyclonal Anti-STX1A Antibody (N-Terminus)

Applications IHC
Reactivities Human
Immunogen STX1A / Syntaxin 1A antibody was raised against synthetic 15 amino acid peptide from N-Terminus of human STX1A / Syntaxin 1A. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Marmoset, Mouse, Rat, Hamster, Pig, Xenopus (100%); Panda, Dog, Bat, Bovine, Horse, Opossum, Turkey, Chicken (93%); Elephant (87%); Drosophila, Mosquito, Water flea, Nematode, Beetle (80%).

Rabbit Polyclonal Anti-STX1A Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen STX1A / Syntaxin 1A antibody was raised against synthetic 16 amino acid peptide from internal region of human STX1A / Syntaxin 1A. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Pig, Opossum, Turkey, Chicken (100%); Horse, Xenopus (94%); Gibbon, Sheep, Zebra finch, Salmon, Stickleback, Pufferfish, Zebrafish, Ant, Water flea (88%); Beetle (81%).

Anti-STX1A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1-15 amino acids of human syntaxin 1A (brain)

Anti-STX1A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1-15 amino acids of human syntaxin 1A (brain)