Antibodies

View as table Download

Rabbit anti-ETV6 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ETV6

Rabbit polyclonal ETV6 Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ETV6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 84-111 amino acids from the N-terminal region of human ETV6.

Rabbit polyclonal anti-ETV6 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ETV6.

Rabbit Polyclonal Anti-ETV6 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ETV6 antibody: synthetic peptide directed towards the C terminal of human ETV6. Synthetic peptide located within the following region: VSVSPPEEHAMPIGRIADCRLLWDYVYQLLSDSRYENFIRWEDKESKIFR

Rabbit Polyclonal Anti-ETV6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ETV6 antibody: synthetic peptide directed towards the N terminal of human ETV6. Synthetic peptide located within the following region: WAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHIL