Antibodies

View as table Download

ATXN3 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ATXN3

Ataxin 3 (ATXN3) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 267~297 amino acids from the Center region of human ATXN3

Rabbit Polyclonal antibody to Ataxin 3 (ataxin 3)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 245 of Ataxin 3 (Uniprot ID#P54252)

Rabbit Polyclonal Anti-ATXN3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATXN3 antibody: synthetic peptide directed towards the N terminal of human ATXN3. Synthetic peptide located within the following region: SIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNAL