Antibodies

Jump to Filters
View as table Download
HOXB6 (Center) Rabbit Polyclonal Antibody
AP52079PU-N

USD 450.00

2 Weeks

HOXB6 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 128-155 amino acids from the Central region of Human HOXB6 / HOX2B
HOXB6 Rabbit Polyclonal Antibody
TA329257

USD 375.00

5 Days

Rabbit Polyclonal anti-HOXB6 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXB6 antibody: synthetic peptide directed towards the N terminal of human HOXB6. Synthetic peptide located within the following region: ALSGADEQPPFHPEPRKSDCAQDKSVFGETEEQKCSTPVYPWMQRMNSCN