HOXB6 Rabbit Polyclonal Antibody

CAT#: TA329257

Rabbit Polyclonal anti-HOXB6 antibody

Product Images

WB Suggested Anti-HOXB6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: Human Intestine

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HOXB6 antibody: synthetic peptide directed towards the N terminal of human HOXB6. Synthetic peptide located within the following region: ALSGADEQPPFHPEPRKSDCAQDKSVFGETEEQKCSTPVYPWMQRMNSCN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: homeobox B6
• Database Link:
  NP_061825
  Entrez Gene 3216 Human
  UniProt ID P17509
• Background: HOXB6 belongs to the homeobox family. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17.
• Synonyms: Hox-2.2; HOX2; HOX2B; HU-2
• Note: Immunogen sequence homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 92%; Dog: 79%

Reference Data

• Protein Families: Transcription Factors