Antibodies

Jump to Filters
View as table Download
B MyB (MYBL2) Rabbit Polyclonal Antibody
AP20207PU-N

USD 407.00

2 Weeks

B MyB (MYBL2) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
B MyB (MYBL2) Rabbit Polyclonal Antibody
TA330054

USD 375.00

5 Days

Rabbit Polyclonal Anti-MYBL2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYBL2 antibody: synthetic peptide directed towards the N terminal of human MYBL2. Synthetic peptide located within the following region: RCEDLDELHYQDTDSDVPEQRDSKCKVKWTHEEDEQLRALVRQFGQQDWK