B MyB (MYBL2) Rabbit Polyclonal Antibody

CAT#: TA330054

Rabbit Polyclonal Anti-MYBL2 Antibody

Product Images

WB Suggested Anti-MYBL2 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysateMYBL2 is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Human Spermatophore

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MYBL2 antibody: synthetic peptide directed towards the N terminal of human MYBL2. Synthetic peptide located within the following region: RCEDLDELHYQDTDSDVPEQRDSKCKVKWTHEEDEQLRALVRQFGQQDWK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 79 kDa
• Gene Name: MYB proto-oncogene like 2
• Database Link:
  NP_002457
  Entrez Gene 4605 Human
  UniProt ID P10244
• Background: Myb-Related Protein B (MYBL2), a member of the MYB family of transcription factor genes, is a nuclear protein involved in cell cycle progression. The encoded protein is phosphorylated by cyclin A/cyclin-dependent kinase 2 during the S-phase of the cell cycle and possesses both activator and repressor activities. It has been shown to activate the cell division cycle 2, cyclin D1, and insulin-like growth factor-binding protein 5 genes. Transcript variants may exist for this gene, but their full-length natures have not been determined.
• Synonyms: B-MYB; BMYB
• Note: Immunogen sequence homology: Bovine: 100%; Chicken: 100%; Dog: 100%; Horse: 100%; Human: 100%; Rabbit: 92%; Guinea pig: 85%; Zebrafish: 83%; Rat: 78%

Reference Data

• Protein Families: Druggable Genome, Stem cell - Pluripotency, Transcription Factors