B MyB (MYBL2) Rabbit Polyclonal Antibody

CAT#: TA330054

Rabbit Polyclonal Anti-MYBL2 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "MYBL2"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MYBL2 antibody: synthetic peptide directed towards the N terminal of human MYBL2. Synthetic peptide located within the following region: RCEDLDELHYQDTDSDVPEQRDSKCKVKWTHEEDEQLRALVRQFGQQDWK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 79 kDa
Gene Name MYB proto-oncogene like 2
Background Myb-Related Protein B (MYBL2), a member of the MYB family of transcription factor genes, is a nuclear protein involved in cell cycle progression. The encoded protein is phosphorylated by cyclin A/cyclin-dependent kinase 2 during the S-phase of the cell cycle and possesses both activator and repressor activities. It has been shown to activate the cell division cycle 2, cyclin D1, and insulin-like growth factor-binding protein 5 genes. Transcript variants may exist for this gene, but their full-length natures have not been determined.
Synonyms B-MYB; BMYB
Note Immunogen sequence homology: Bovine: 100%; Chicken: 100%; Dog: 100%; Horse: 100%; Human: 100%; Rabbit: 92%; Guinea pig: 85%; Zebrafish: 83%; Rat: 78%
Reference Data
Protein Families Druggable Genome, Stem cell - Pluripotency, Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.