Antibodies

Jump to Filters
View as table Download
NFIL3 Rabbit Polyclonal Antibody
TA312224

USD 345.00

In Stock

Rabbit polyclonal anti-NFIL3 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NFIL3.
NFIL3 (N-term) Rabbit Polyclonal Antibody
AP52862PU-N

USD 450.00

2 Weeks

NFIL3 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 45-74aa) of human NFIL3.
NFIL3 Rabbit Polyclonal Antibody
TA329213

USD 375.00

5 Days

Rabbit Polyclonal anti-NFIL3 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NFIL3 antibody: synthetic peptide directed towards the middle region of human NFIL3. Synthetic peptide located within the following region: GYSHSPPLLQVNRSSSNSPRTSETDDGVVGKSSDGEDEQQVPKGPIHSPV
NFIL3 Rabbit Polyclonal Antibody
TA343536

USD 310.00

5 Days

Rabbit Polyclonal Anti-NFIL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NFIL3 antibody: synthetic peptide directed towards the N terminal of human NFIL3. Synthetic peptide located within the following region: MQLRKMQTVKKEQASLDASSNVDKMMVLNSALTEVSEDSTTGEDVLLSEG