NFIL3 Rabbit Polyclonal Antibody
Other products for "NFIL3"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human, Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-NFIL3 antibody: synthetic peptide directed towards the middle region of human NFIL3. Synthetic peptide located within the following region: GYSHSPPLLQVNRSSSNSPRTSETDDGVVGKSSDGEDEQQVPKGPIHSPV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 51 kDa |
Gene Name | nuclear factor, interleukin 3 regulated |
Database Link | |
Background | NFIL3 is a basic leucine zipper (bZIP) transcription factor that represses or activates transcription in non-osteoblastic cells. NFIL3 play a role in attenuation of PTH target gene transcription in osteoblasts. NFIL3 repression domain interacts specifically with the TBP binding repressor protein Dr1.Glucocorticoid-mediated upregulation of the bZIP transcriptional repressor gene, NFIL3, is dependent on [Ca2+]i levels, and correlates with Glucocorticoid-evoked apoptosis of Glucocorticoid-sensitive CEM-C7-14 cells. NFIL3 is involved in a distinct growth factor-regulated signaling pathway that is responsible for the survival of early B-cell progenitors, and whose alteration by E2A-HLF leads to childhood B lineage leukemia. |
Synonyms | E4BP4; IL3BP1; NF-IL3A; NFIL3A |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Zebrafish: 85% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.