TFB2M (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 368-396 amino acids from the C-terminal region of human TFB2M |
TFB2M (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 368-396 amino acids from the C-terminal region of human TFB2M |
Rabbit Polyclonal Anti-TFB2M Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TFB2M antibody: synthetic peptide directed towards the N terminal of human TFB2M. Synthetic peptide located within the following region: MWIPVVGLPRRLRLSALAGAGRFCILGSEAATRKHLPARNHCGLSDSSPQ |
Rabbit Polyclonal Anti-TFB2M Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TFB2M antibody: synthetic peptide directed towards the C terminal of human TFB2M. Synthetic peptide located within the following region: ATVIDHLRSLTPLDARDILMQIGKQEDEKVVNMHPQDFKTLFETIERSKD |
Rabbit Polyclonal Anti-TFB2M Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TFB2M Antibody: synthetic peptide directed towards the N terminal of human TFB2M. Synthetic peptide located within the following region: ECNPGPGILTQALLEAGAKVVALESDKTFIPHLESLGKNLDGKLRVIHCD |