Antibodies

View as table Download

Rabbit Polyclonal Anti-ZNF398 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF398 antibody: synthetic peptide directed towards the N terminal of human ZNF398. Synthetic peptide located within the following region: AEAAPAPTSEWDSECLTSLQPLPLPTPPAANEAHLQTAAISLWTVVAAVQ

Rabbit Polyclonal Anti-ZNF398 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF398 antibody: synthetic peptide directed towards the C terminal of human ZNF398. Synthetic peptide located within the following region: GCGGDSDPSGQPPNPPGPLITGLETSGLGVNTEGLETNQWYGEGSGGGVL

Rabbit polyclonal antibody to ZNF398 (zinc finger protein 398)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 358 and 642 of ZNF398 (Uniprot ID#Q8TD17)

Rabbit Polyclonal Anti-ZNF398 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ZNF398 Antibody: synthetic peptide directed towards the middle region of human ZNF398. Synthetic peptide located within the following region: NLSQDMLLTHQCSHATEHPLPCAQCPKHFTPQADLSSTSQDHASETPPTC