Antibodies

View as table Download

Rabbit Polyclonal Anti-TIM3 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TIM3 antibody was raised against a peptide corresponding to 16 amino acids near the amino terminus of human TIM3. The immunogen is located within amino acids 60 - 110 of TIM3.

Rabbit anti-HAVCR2 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HAVCR2

Rabbit polyclonal anti-Tim-3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid residue 285 of human Tim-3

Rabbit Polyclonal Anti-HAVCR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HAVCR2 antibody: synthetic peptide directed towards the N terminal of human HAVCR2. Synthetic peptide located within the following region: MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVP