Antibodies

Jump to Filters
View as table Download
GLUT9 (SLC2A9) Rabbit Polyclonal Antibody
TA309865

USD 402.00

5 Days

Rabbit Polyclonal GLUT9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human protein (within residues 10-60). [Swiss-Prot# Q9NRM0]
GLUT9 (SLC2A9) Rabbit Polyclonal Antibody
TA334159

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC2A9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC2A9 Antibody: synthetic peptide directed towards the middle region of human SLC2A9. Synthetic peptide located within the following region: VVTVIVTMACYQLCGLNAIWFYTNSIFGKAGIPPAKIPYVTLSTGGIETL