GLUT9 (SLC2A9) Rabbit Polyclonal Antibody

CAT#: TA334159

Rabbit Polyclonal Anti-SLC2A9 Antibody

Product Images

Host: Rabbit; Target Name: SLC2A9; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml

• 

  WB Suggested Anti-SLC2A9 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: HepG2 cell lysate;SLC2A9 is supported by BioGPS gene expression data to be expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC2A9 Antibody: synthetic peptide directed towards the middle region of human SLC2A9. Synthetic peptide located within the following region: VVTVIVTMACYQLCGLNAIWFYTNSIFGKAGIPPAKIPYVTLSTGGIETL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: solute carrier family 2 member 9
• Database Link:
  NP_001001290
  Entrez Gene 56606 Human
  UniProt ID Q9NRM0
• Background: SLC2A9 is a member of the SLC2A facilitative glucose transporter family. Members of this family play a significant role in maintaining glucose homeostasis. SLC2A9 may play a role in the development and survival of chondrocytes in cartilage matrices.This gene encodes a member of the SLC2A facilitative glucose transporter family. Members of this family play a significant role in maintaining glucose homeostasis. The encoded protein may play a role in the development and survival of chondrocytes in cartilage matrices. Two transcript variants encoding distinct isoforms have been identified for this gene.
• Synonyms: GLUT9; GLUTX; UAQTL2; URATv1
• Note: Immunogen sequence homology: Human: 100%; Horse: 93%; Pig: 91%; Guinea pig: 91%; Dog: 86%; Mouse: 86%; Bovine: 86%; Rat: 79%; Rabbit: 79%

Reference Data

• Protein Families: Transmembrane