Rabbit monoclonal antibody against Phospho CrkL (pY207)(EP270Y) (phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Modifications | Phospho-specific |
Rabbit monoclonal antibody against Phospho CrkL (pY207)(EP270Y) (phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Modifications | Phospho-specific |
Rabbit Polyclonal anti-CRKL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CRKL antibody is: synthetic peptide directed towards the middle region of Human CRKL. Synthetic peptide located within the following region: RSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPS |
Rabbit Polyclonal Anti-CRKL Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CRKL |