BCLAF1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human BCLAF1 |
BCLAF1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human BCLAF1 |
Rabbit polyclonal anti-BCLAF1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BCLAF1. |
Rabbit Polyclonal Anti-BCLAF1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | BCLAF1 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human BCLAF1. The immunogen is located within amino acids 820 - 870 of BCLAF1. |
Rabbit Polyclonal Anti-Bclaf1 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Bclaf1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TDGDWDDQEVLDYFSDKESAKQKFHDSEGDDTEETEDYRQFRKSVLADQG |
Rabbit Polyclonal Anti-BCLAF1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human BCLAF1 |
BCLAF1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 600 to the C-terminus of human BCLAF1 (NP_001070909.1). |
Modifications | Unmodified |