Antibodies

View as table Download

BCLAF1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human BCLAF1

Rabbit polyclonal anti-BCLAF1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human BCLAF1.

Rabbit Polyclonal Anti-BCLAF1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen BCLAF1 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human BCLAF1. The immunogen is located within amino acids 820 - 870 of BCLAF1.

Rabbit Polyclonal Anti-Bclaf1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Bclaf1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TDGDWDDQEVLDYFSDKESAKQKFHDSEGDDTEETEDYRQFRKSVLADQG

Rabbit Polyclonal Anti-BCLAF1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human BCLAF1

BCLAF1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 600 to the C-terminus of human BCLAF1 (NP_001070909.1).
Modifications Unmodified