Rabbit Polyclonal Anti-CBX2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CBX2 antibody: synthetic peptide directed towards the middle region of human CBX2. Synthetic peptide located within the following region: SDSDPDSASPPSTGQNPSVSVQTSQDWKPTRSLIEHVFVTDVTANLITVT |
Rabbit Polyclonal Anti-CBX2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CBX2 antibody: synthetic peptide directed towards the N terminal of human CBX2. Synthetic peptide located within the following region: SSSSSSSTSSSSSSDEEDDSDLDAKRGPRGRETHPVPQKKAQILVAKPEL |
Anti-CBX2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
CBX2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 62-211 of human CBX2 (NP_116036.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
