CBX2 Rabbit Polyclonal Antibody

CAT#: TA344361

Rabbit Polyclonal Anti-CBX2 Antibody - middle region

Product Images

WB Suggested Anti-CBX2 Antibody Titration: 0.2-1 ug/ml; Positive Control: OVCAR-3 cell lysateCBX2 is supported by BioGPS gene expression data to be expressed in OVCAR3

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CBX2 antibody: synthetic peptide directed towards the middle region of human CBX2. Synthetic peptide located within the following region: SDSDPDSASPPSTGQNPSVSVQTSQDWKPTRSLIEHVFVTDVTANLITVT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: chromobox 2
• Database Link:
  NP_005180
  Entrez Gene 84733 Human
  UniProt ID Q14781
• Background: CBX2 Contains 1 A.T hook DNA-binding domain and 1 chromo domain. CBX2 is a component of the Polycomb group (PcG) multiprotein PRC1 complex, a complex required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility.
• Synonyms: CDCA6; M33; SRXY5
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 93%; Bovine: 86%; Pig: 79%; Rat: 79%

Reference Data

• Protein Families: Transcription Factors