Rabbit polyclonal RAT Ccnl2 Antibody (C-term)
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | This RAT Ccnl2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 422-450 amino acids from the C-terminal region of rat Ccnl2. |
Rabbit Polyclonal Anti-CCNL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCNL2 antibody: synthetic peptide directed towards the N terminal of human CCNL2. Synthetic peptide located within the following region: TGQVLFQRFFYTKSFVKHSMEHVSMACVHLASKIEEAPRRIRDVINVFHR |
Cyclin L2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 60-150 of human Cyclin L2 (NP_001307082.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China