Antibodies

View as table Download

DGAT1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human DGAT1

Rabbit polyclonal anti-DGAT1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to residues surrounding amino acids 308 of mouse DGAT-1

Rabbit Polyclonal Anti-DGAT1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Dgat1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Dgat1. Synthetic peptide located within the following region: HRLQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKYGILVDPI

Rabbit Polyclonal Anti-DGAT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human DGAT1

DGAT1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human DGAT1 (NP_036211.2).
Modifications Unmodified

DGAT1 Rabbit monoclonal Antibody

Applications IHC, IP, WB
Reactivities Human
Conjugation Unconjugated