DGAT1 Rabbit Polyclonal Antibody

CAT#: TA343309

Rabbit Polyclonal Anti-DGAT1 Antibody

Product Images

Host: Rabbit; Target Name: Dgat1; Sample Tissue: Mouse Heart lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Dgat1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Dgat1. Synthetic peptide located within the following region: HRLQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKYGILVDPI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: diacylglycerol O-acyltransferase 1
• Database Link:
  NP_036211
  Entrez Gene 13350 Mouse
  UniProt ID O75907
• Background: Dgat1 catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. In contrast to DGAT2 it is not essential for survival. It may be involved in VLDL (very low density lipoprotein) assembly. In liver, Dgat1 plays a role in esterifying exogenous fatty acids to glycerol. It functions as the major acyl-CoA retinol acyltransferase (ARAT) in the skin, where it acts to maintain retinoid homeostasis and prevent retinoid toxicity leading to skin and hair disorders.
• Synonyms: ARAT; ARGP1; DGAT; DIAR7
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Guinea pig: 93%; Zebrafish: 86%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Glycerolipid metabolism, Metabolic pathways, Retinol metabolism