Antibodies

View as table Download

Rabbit monoclonal antibody against HNF 3 Beta(clone EPR4466)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-FOXA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXA2 antibody: synthetic peptide directed towards the N terminal of human FOXA2. Synthetic peptide located within the following region: MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAA

Rabbit Polyclonal Anti-FOXA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXA2 antibody: synthetic peptide directed towards the C terminal of human FOXA2. Synthetic peptide located within the following region: QVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNS

Anti-FOXA2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 311-325 amino acids of Human forkhead box A2

Rabbit polyclonal FOXA2 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 128-157 amino acids from the Central region of human FOXA2.

Rabbit polyclonal FOXA2 Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 380-407 amino acids from the C-terminal region of human FOXA2.

Rabbit Polyclonal FOXA2 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen FOXA2 antibody was raised against a 16 amino acid peptide near the center of human FOXA2 .

Rabbit Polyclonal Anti-FOXA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXA2 antibody: synthetic peptide directed towards the middle region of human FOXA2. Synthetic peptide located within the following region: ASQAQLGEAAGPASETPAGTESPHSSASPCQEHKRGGLGELKGTPAAALS

Rabbit Polyclonal Anti-Foxa2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Foxa2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VDVEGTDYLNGDLGWSSSVSDSDERGSMQSLGSDEGYSSATVKRAKLQDG

Rabbit Polyclonal Anti-Foxa2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Foxa2 antibody: synthetic peptide directed towards the middle region of mouse Foxa2. Synthetic peptide located within the following region: SSGGKKTAPGSQASQAQLGEAAGSASETPAGTESPHSSASPCQEHKRGGL

Rabbit anti FOXA-2 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the C-terminus of human FOXA2 protein. This sequence is identical to rat, mouse and human origins.

HNF3β/FOXA2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human HNF3β/HNF3β/FOXA2
Modifications Unmodified