Antibodies

Jump to Filters
View as table Download
Repulsive Guidance Molecule C (HFE2) Rabbit Polyclonal Antibody
TA332627

USD 275.00

3 Weeks

Rabbit anti-HFE2 Polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HFE2
Repulsive Guidance Molecule C (HFE2) Rabbit Polyclonal Antibody
TA337622

USD 375.00

5 Days

Rabbit Polyclonal Anti-HFE2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HFE2 antibody: synthetic peptide directed towards the N terminal of human HFE2. Synthetic peptide located within the following region: SSLSIQTANPGNHVEIQAAYIGTTIIIRQTAGQLSFSIKVAEDVAMAFSA