Antibodies

Jump to Filters
View as table Download
KCNJ1 Rabbit Polyclonal Antibody
TA338741

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCNJ1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNJ1 antibody: synthetic peptide directed towards the middle region of human KCNJ1. Synthetic peptide located within the following region: LRKSLLIGSHIYGKLLKTTVTPEGETIILDQININFVVDAGNENLFFISP
KCNJ1 Rabbit Polyclonal Antibody
TA377714

USD 220.00

3 Weeks

KCNJ1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 182-391 of human KCNJ1 (NP_000211.1).
Modifications Unmodified