KCNJ1 Rabbit Polyclonal Antibody

CAT#: TA338741

Rabbit Polyclonal Anti-KCNJ1 Antibody

Product Images

Lanes: ; Lane 1: 30ug mouse renal epithelial lysate; Lane 2: 30ug mouse renal epithelial lysate; Lane 3: 30ug mouse renal epithelial lysate; Primary Antibody Dilution: ; 1:500; Secondary Antibody: ; Anti-rabbit-HRP; Secondary Antibody Dilution: ; 1:2500;

• 

  WB Suggested Anti-KCNJ1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KCNJ1 antibody: synthetic peptide directed towards the middle region of human KCNJ1. Synthetic peptide located within the following region: LRKSLLIGSHIYGKLLKTTVTPEGETIILDQININFVVDAGNENLFFISP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: potassium voltage-gated channel subfamily J member 1
• Database Link:
  NP_000211
  Entrez Gene 56379 MouseEntrez Gene 3758 Human
  UniProt ID P48048
• Background: Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. It is activated by internal ATP and probably plays an important role in potassium homeostasis. The encoded protein has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Mutations in this gene have been associated with antenatal Bartter syndrome, which is characterized by salt wasting, hypokalemic alkalosis, hypercalciuria, and low blood pressure. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Synonyms: KIR1.1; ROMK; ROMK1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Bovine: 86%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Potassium, Transmembrane