Antibodies

View as table Download

Rabbit Polyclonal Anti-MXD3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MXD3 antibody: synthetic peptide directed towards the N terminal of human MXD3. Synthetic peptide located within the following region: MEPLASNIQVLLQAAEFLERREREAEHGYASLCPHRSPGPIHRRKKRPPQ

Rabbit Polyclonal Anti-MXD3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MXD3 antibody is: synthetic peptide directed towards the C-terminal region of Human MXD3. Synthetic peptide located within the following region: RLRADSLDSSGLSSERSDSDQEELEVDVESLVFGGEAELLRGFVAGQEHS

Rabbit Polyclonal anti-MXD3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MXD3 antibody: synthetic peptide directed towards the N terminal of human MXD3. Synthetic peptide located within the following region: PIHRRKKRPPQAPGAQDSGRSVHNELEKRRRAQLKRCLERLKQQMPLGAD