MAD3 (MXD3) Rabbit Polyclonal Antibody

CAT#: TA329109

Rabbit Polyclonal anti-MXD3 antibody

Product Images

WB Suggested Anti-MXD3 Antibody Titration: 0.5ug/ml; ELISA Titer: 1:312500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MXD3 antibody: synthetic peptide directed towards the N terminal of human MXD3. Synthetic peptide located within the following region: PIHRRKKRPPQAPGAQDSGRSVHNELEKRRRAQLKRCLERLKQQMPLGAD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: MAX dimerization protein 3
• Database Link:
  NP_112590
  Entrez Gene 83463 Human
  UniProt ID Q9BW11
• Background: MXD3 contains 1 basic helix-loop-helix (bHLH) domain. It is a transcriptional repressor and binds with MAX to form a sequence-specific DNA-binding protein complex which recognizes the core sequence 5'-CAC[GA]TG-3'. Antagonizes MYC transcriptional activity by competing for MAX and suppresses MYC dependent cell transformation.
• Synonyms: BHLHC13; MAD3; MYX
• Note: Immunogen sequence homology: Human: 100%; Rat: 93%; Horse: 93%; Bovine: 93%; Dog: 86%; Pig: 86%; Rabbit: 86%; Mouse: 85%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors