Antibodies

View as table Download

Rabbit Polyclonal Anti-BTBD14B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BTBD14B antibody: synthetic peptide directed towards the C terminal of human BTBD14B. Synthetic peptide located within the following region: WMPKVKVLKAEDDAYTTFISETGKIEPDMMGVEHGFETASHEGEAGPSAE

Rabbit Polyclonal Anti-BTBD14B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BTBD14B antibody: synthetic peptide directed towards the middle region of human BTBD14B. Synthetic peptide located within the following region: EGMDEQYRQICNMYTMYSMMNVGQTAEKVEALPEQVAPESRNRIRVRQDL

Rabbit Polyclonal Anti-NACC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BTBD14B antibody: synthetic peptide directed towards the middle region of human BTBD14B. Synthetic peptide located within the following region: VVSGPSTSERTSPGTSSAYTSDSPGSYHNEEDEEEDGGEEGMDEQYRQIC

NACC1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 170-340 of human NACC1 (NP_443108.1).
Modifications Unmodified

NACC1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 170-340 of human NACC1 (NP_443108.1).
Modifications Unmodified