Nac1 (NACC1) Rabbit Polyclonal Antibody

CAT#: TA337274

Rabbit Polyclonal Anti-NACC1 Antibody

Product Images

WB Suggested Anti-BTBD14B Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: 721_B cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BTBD14B antibody: synthetic peptide directed towards the middle region of human BTBD14B. Synthetic peptide located within the following region: VVSGPSTSERTSPGTSSAYTSDSPGSYHNEEDEEEDGGEEGMDEQYRQIC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: nucleus accumbens associated 1
• Database Link:
  NP_443108
  Entrez Gene 112939 Human
  UniProt ID Q96RE7
• Background: Members of the BTB/POZ family of transcriptional regulators, including BTBD14B, contain a conserved motif in the N-terminal region critical for protein-protein interactions and assembly of high molecular mass complexes.Members of the BTB/POZ family of transcriptional regulators, including BTBD14B, contain a conserved motif in the N-terminal region critical for protein-protein interactions and assembly of high molecular mass complexes (Korutla et al., 2002 [PubMed 11906783]). [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-42 BU508302.1 1-42 43-1846 AF395817.1 1-1804 1847-3973 AK094702.1 454-2580 3974-4556 BC055396.1 3917-4499
• Synonyms: BEND8; BTBD14B; BTBD30; NAC-1; NAC1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%

Reference Data

• Protein Families: ES Cell Differentiation/IPS, Stem cell - Pluripotency