Antibodies

Jump to Filters
View as table Download
Ninjurin 1 (NINJ1) Rabbit Polyclonal Antibody
TA349100

USD 484.00

2 Weeks

Rabbit Polyclonal Anti-NINJ1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen NINJ1 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human NINJ1.
Ninjurin 1 (NINJ1) Rabbit Polyclonal Antibody
TA339395

USD 375.00

5 Days

Rabbit Polyclonal Anti-NINJ1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NINJ1 antibody: synthetic peptide directed towards the N terminal of human NINJ1. Synthetic peptide located within the following region: DSGTEEYELNGGLPPGTPGSPDASPARWGWRHGPINVNHYASKKSAAESM
Ninjurin 1 (NINJ1) Rabbit Polyclonal Antibody
TA379132

USD 220.00

3 Weeks

NINJ1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NINJ1 (NP_004139.2).
Modifications Unmodified