Ninjurin 1 (NINJ1) Rabbit Polyclonal Antibody

CAT#: TA339395

Rabbit Polyclonal Anti-NINJ1 Antibody

Product Images

WB Suggested Anti-NINJ1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NINJ1 antibody: synthetic peptide directed towards the N terminal of human NINJ1. Synthetic peptide located within the following region: DSGTEEYELNGGLPPGTPGSPDASPARWGWRHGPINVNHYASKKSAAESM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 16 kDa
• Gene Name: ninjurin 1
• Database Link:
  NP_004139
  Entrez Gene 4814 Human
  UniProt ID Q92982
• Background: The ninjurin protein is upregulated after nerve injury both in dorsal root ganglion neurons and in Schwann cells (Araki and Milbrandt, 1996 [PubMed 8780658]). It demonstrates properties of a homophilic adhesion molecule and promotes neurite outgrowth from primary cultured dorsal root ganglion neurons. [supplied by OMIM, Aug 2009]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC048212.1, BC019336.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025084 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
• Synonyms: NIN1; NINJURIN
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 91%; Rat: 79%; Mouse: 79%

Reference Data

• Protein Families: Transmembrane